PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G135900.1.p
Common NameLOC101758129, SETIT_002353mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 308aa    MW: 32825.7 Da    PI: 10.5536
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G135900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-15116160347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  Seita.5G135900.1.p 116 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 160
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.171109165IPR017930Myb domain
SuperFamilySSF466893.14E-18110166IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-19112164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-11113159IPR009057Homeodomain-like
SMARTSM007171.5E-11113163IPR001005SANT/Myb domain
CDDcd001676.15E-10116161No hitNo description
PfamPF002492.5E-12116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCGG NGRVMMENGG GGVRLFGVQL HVGSSSPMKK CFSMECLSSA  60
APAAYYAAAL AASSSSPSVS SSSSLVSVEE TAEKVTNGYL SDGLMGRAQE RKKGVPWTED  120
EHRRFLAGLE KLGKGDWRGI SRHFVTTRTP TQVASHAQKY FLRQSSLTHK KRRSSLFDVV  180
ENADRAATSA NERLRQRRGG GLGAGHGAPG SVSRHHQPAG EARAHPASEP FVPAATVLIG  240
DEQQQREHVA ERAAPRQKHP SSLTLSKPHH ASLQQAAPDL ELKISTTADY QAGSSPRTPF  300
FGTIRVT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9670991e-147EU967099.1 Zea mays clone 299455 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660810.10.0PREDICTED: uncharacterized protein LOC101758129
TrEMBLK3XKD00.0K3XKD0_SETIT; Uncharacterized protein
STRINGSi002353m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.17e-49MYB_related family protein